DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MEP1A and CG15253

DIOPT Version :9

Sequence 1:XP_011512930.1 Gene:MEP1A / 4224 HGNCID:7015 Length:774 Species:Homo sapiens
Sequence 2:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster


Alignment Length:223 Identity:83/223 - (37%)
Similarity:113/223 - (50%) Gaps:12/223 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    76 LAAGLDLFQGDILLQ-KSRNGLRDPNTRWTFPIPYI-LADNLGLNAKGAILYAFEMFRLKSCVDF 138
            |.||  ..:||::.. .|||..|:...||...|.|. :...:....:..|:.|.:.....||:.|
  Fly    31 LTAG--YIEGDMVPSGSSRNIWRNETYRWPNRIIYYHINSYIDEEHRNHIVSAIQKIESISCLTF 93

Human   139 KPYEGESSYI--IFQQFDGCWSEVG-----DQHVGQNISIGQGCAYKAIIEHEILHALGFYHEQS 196
            |....:..|.  :..:..||:|.:|     .|...||..||.||.....|.||.||||||:|:||
  Fly    94 KEATTDQKYYVNVTSEEGGCFSYIGYLNRVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQS 158

Human   197 RTDRDDYVNIWWDQILSGYQHNFDTYDDSLITDLNTPYDYESLMHYQPFSFNKNASVPTITAKIP 261
            ..||||||.|..:.|..|.:.|||.|.:..:.|....|||.|:|||.|::|:||.. .||.|...
  Fly   159 AADRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSKNGE-RTILALEE 222

Human   262 EFNSIIGQRLDFSAIDLERLNRMYNCTT 289
            ....:|||||:.|..|:.:||.:|.|.|
  Fly   223 GKEDVIGQRLELSETDIRKLNAIYKCPT 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MEP1AXP_011512930.1 ZnMc_meprin 58..287 CDD:239809 81/219 (37%)
Astacin 101..289 CDD:279708 73/195 (37%)
MAM 292..459 CDD:214533
MAM 297..459 CDD:99706
MATH_Meprin_Alpha 459..622 CDD:239752
EGF_CA 700..738 CDD:238011
CG15253NP_609758.1 Astacin 55..250 CDD:279708 73/195 (37%)
ZnMc_astacin_like 59..246 CDD:239807 69/187 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41174
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.