DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and HNRNPDL

DIOPT Version :10

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_112740.1 Gene:HNRNPDL / 9987 HGNCID:5037 Length:420 Species:Homo sapiens


Alignment Length:92 Identity:24/92 - (26%)
Similarity:48/92 - (52%) Gaps:1/92 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNLNGY 80
            :.||||.:..:.:||::||.|...|.:.:::|..|.::.:.:||.|..|.|:|.....:.: ..:
Human   233 KKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLES-RYH 296

  Fly    81 EIGGRTLRVDNACTEKSRMEMQQLLQG 107
            :||.....:..|..::...:.||..:|
Human   297 QIGSGKCEIKVAQPKEVYRQQQQQQKG 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 21/77 (27%)
CSTF2_hinge 111..190 CDD:433869
CSTF_C 377..416 CDD:464130
HNRNPDLNP_112740.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..83
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 96..120
RRM1_hnRPDL 149..224 CDD:410152
RRM2_hnRPDL 234..308 CDD:409998 20/74 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 313..348 3/11 (27%)
Necessary for interaction with TNPO1. /evidence=ECO:0000269|PubMed:9524220 342..420
Necessary for its nuclear import and export 396..420
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..420
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.