DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and SRSF9

DIOPT Version :9

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_003760.1 Gene:SRSF9 / 8683 HGNCID:10791 Length:221 Species:Homo sapiens


Alignment Length:127 Identity:35/127 - (27%)
Similarity:57/127 - (44%) Gaps:14/127 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNLNGYEI 82
            ::|||:|.:..|:.|:::|.:.|.:..::|. :|....|  |.|..::|...|..|:...|||:.
Human    16 IYVGNLPTDVREKDLEDLFYKYGRIREIELK-NRHGLVP--FAFVRFEDPRDAEDAIYGRNGYDY 77

  Fly    83 GGRTLRVDNACTEKSRMEMQQLLQGPQVENPYGEPCEPEDAPELITKTVASLPPEQMYELMK 144
            |...|||:...|...|       .|.......|.|....|...|    |:.|||...::.:|
Human    78 GQCRLRVEFPRTYGGR-------GGWPRGGRNGPPTRRSDFRVL----VSGLPPSGSWQDLK 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM <13..>112 CDD:223796 26/93 (28%)
RRM_CSTF2_CSTF2T 18..92 CDD:241115 23/73 (32%)
CSTF2_hinge 112..190 CDD:291025 9/33 (27%)
CSTF_C 377..416 CDD:291002
SRSF9NP_003760.1 RRM1_SRSF9 15..86 CDD:241042 23/72 (32%)
RRM2_SRSF9 104..186 CDD:410161 8/29 (28%)
Interaction with SAFB1 188..200
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..221
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.