DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and SNP1

DIOPT Version :10

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_012203.1 Gene:SNP1 / 854749 SGDID:S000001323 Length:300 Species:Saccharomyces cerevisiae


Alignment Length:78 Identity:23/78 - (29%)
Similarity:45/78 - (57%) Gaps:3/78 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNL--- 77
            |::|:|.:||:..|.:|::.|.:.|.:..:::|.|:.:.|.||:.|..:||..::..|.:.:   
Yeast   107 RTIFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAFKEIGVH 171

  Fly    78 NGYEIGGRTLRVD 90
            .|.:|..|...||
Yeast   172 RGIQIKDRICIVD 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 23/78 (29%)
CSTF2_hinge 111..190 CDD:433869
CSTF_C 377..416 CDD:464130
SNP1NP_012203.1 U1snRNP70_N 6..97 CDD:432406
RRM_SNP1_like 89..201 CDD:410194 23/78 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.