DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and RIE1

DIOPT Version :9

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_011766.3 Gene:RIE1 / 853165 SGDID:S000003482 Length:781 Species:Saccharomyces cerevisiae


Alignment Length:140 Identity:40/140 - (28%)
Similarity:69/140 - (49%) Gaps:21/140 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNLNGYE 81
            ::|||.|....:..:|..:||:.||:||:||::|:..|:|.|:||..|.....|...::.|||..
Yeast   196 NIFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISYPLGSQASLCIKELNGRT 260

  Fly    82 IGGRTLRVDNAC--TEKSRMEMQQLLQGPQVEN---------PYGEPCEPEDAPELITKTVASLP 135
            :.|.||.::...  .|:.|:....:.:....:|         ||.   .||....|||       
Yeast   261 VNGSTLFINYHVERKERERIHWDHVKENNNDDNFRCLFIGNLPYH---NPEKVETLIT------- 315

  Fly   136 PEQMYELMKQ 145
            |:::.|::|:
Yeast   316 PKEVIEVIKK 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM <13..>112 CDD:223796 29/96 (30%)
RRM_CSTF2_CSTF2T 18..92 CDD:241115 27/73 (37%)
CSTF2_hinge 112..190 CDD:291025 11/43 (26%)
CSTF_C 377..416 CDD:291002
RIE1NP_011766.3 PABP-1234 195..757 CDD:130689 40/140 (29%)
RRM3_CELF1-6 542..634 CDD:409797
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.