powered by:
Protein Alignment CstF64 and NOP6
DIOPT Version :9
Sequence 1: | NP_477453.1 |
Gene: | CstF64 / 42239 |
FlyBaseID: | FBgn0027841 |
Length: | 419 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_010068.1 |
Gene: | NOP6 / 851313 |
SGDID: | S000002372 |
Length: | 225 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 61 |
Identity: | 16/61 - (26%) |
Similarity: | 27/61 - (44%) |
Gaps: | 7/61 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 VFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNLN 78
||||::|.:.|..:|:..|....|. .::|..| ||..|.|:...:......|.::
Yeast 80 VFVGSLPRDITAVELQNHFKNSSPD-QIRLRAD------KGIAFLEFDADKDRTGIQRRMD 133
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0724 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.