DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and AT1G73530

DIOPT Version :10

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_177494.1 Gene:AT1G73530 / 843687 AraportID:AT1G73530 Length:181 Species:Arabidopsis thaliana


Alignment Length:131 Identity:29/131 - (22%)
Similarity:47/131 - (35%) Gaps:35/131 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 KILNRQKIKSLDVVGKIRREIQNLSLFRHPHIIRLYQVISTPS---------DIFMIMEHV---S 106
            :::..:|.....:.|.....|....|..|.|.::..|..:.|.         |.....||:   .
plant   192 RVMYSKKDNMFCIPGSGGHLIGTWDLRTHKHNLQSLQFQNLPKLTKTKQKLLDSCCKSEHLVESP 256

  Fly   107 GGELFDYIVKHGRLKTAEARRFFQQIISGVDYCHRHMVVHRDLKPENLL---LDEQNN-VKIADF 167
            .||.|  :||..:..::       :||.|:          ..:|.:.|:   ||||.| |...|.
plant   257 AGETF--LVKWYKKSSS-------KIIKGI----------AQMKTQALMVFKLDEQGNAVYTQDI 302

  Fly   168 G 168
            |
plant   303 G 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 7/39 (18%)
CSTF2_hinge 111..190 CDD:433869 16/62 (26%)
CSTF_C 377..416 CDD:464130
AT1G73530NP_177494.1 RRM 78..158 CDD:440488
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.