DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and NIFK

DIOPT Version :10

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_115766.3 Gene:NIFK / 84365 HGNCID:17838 Length:293 Species:Homo sapiens


Alignment Length:117 Identity:30/117 - (25%)
Similarity:50/117 - (42%) Gaps:9/117 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KAQEQSIMDKSMRSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQE 68
            |.|||    .:...|:|.::|....|.::...||:.|.|...:|...:.:|..||:.|.|::.::
Human    37 KKQEQ----LTPGVVYVRHLPNLLDETQIFSYFSQFGTVTRFRLSRSKRTGNSKGYAFVEFESED 97

  Fly    69 TALSAMRNLNGYEIGGRTLRVDNACTEKSRMEMQQLLQGPQVENPYGEPCEP 120
            .|......:|.|..|.|.|.......||...|:.:     ....|:.:|..|
Human    98 VAKIVAETMNNYLFGERLLECHFMPPEKVHKELFK-----DWNIPFKQPSYP 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 20/83 (24%)
CSTF2_hinge 111..190 CDD:433869 3/10 (30%)
CSTF_C 377..416 CDD:464130
NIFKNP_115766.3 half-pint 2..>151 CDD:130706 30/117 (26%)
RRM_NIFK_like 46..119 CDD:409748 20/72 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..239
Interaction with MKI67 226..269
hNIFK_binding 227..266 CDD:463489
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 271..293
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.