DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and AT5G06210

DIOPT Version :10

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_196239.1 Gene:AT5G06210 / 830508 AraportID:AT5G06210 Length:146 Species:Arabidopsis thaliana


Alignment Length:92 Identity:32/92 - (34%)
Similarity:52/92 - (56%) Gaps:4/92 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QEQSIMDKSMRSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETA 70
            |.:.:..|    :|:|.:.:..||:.|.|.||:.|.|:..::|.||.|.:.|||||..:...:.|
plant    28 QRRGVASK----LFIGGLSFCTTEQGLSEAFSKCGQVVEAQIVMDRVSDRSKGFGFVTFASADEA 88

  Fly    71 LSAMRNLNGYEIGGRTLRVDNACTEKS 97
            ..|:...||.::.|||:.||.|..::|
plant    89 QKALMEFNGQQLNGRTIFVDYAKAKQS 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 30/83 (36%)
CSTF2_hinge 111..190 CDD:433869
CSTF_C 377..416 CDD:464130
AT5G06210NP_196239.1 RRM_SF 34..113 CDD:473069 30/82 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.