DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and AtRZ-1c

DIOPT Version :10

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_196048.1 Gene:AtRZ-1c / 830307 AraportID:AT5G04280 Length:310 Species:Arabidopsis thaliana


Alignment Length:75 Identity:23/75 - (30%)
Similarity:45/75 - (60%) Gaps:0/75 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNLNGYEI 82
            :|||.:..|.|:..|:..||..|.:|..:::.:|::|:.:||||..:.|:.....::|.::|.:.
plant     9 IFVGGLSPEVTDRDLERAFSRFGDILDCQIMLERDTGRSRGFGFITFADRRAMDESIREMHGRDF 73

  Fly    83 GGRTLRVDNA 92
            |.|.:.|:.|
plant    74 GDRVISVNRA 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 23/75 (31%)
CSTF2_hinge 111..190 CDD:433869
CSTF_C 377..416 CDD:464130
AtRZ-1cNP_196048.1 RRM 8..89 CDD:440488 23/75 (31%)
zf-CCHC 128..143 CDD:395050
U2AF_lg 170..>256 CDD:273727
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.