DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and RSZ22

DIOPT Version :10

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_194886.1 Gene:RSZ22 / 829285 AraportID:AT4G31580 Length:200 Species:Arabidopsis thaliana


Alignment Length:85 Identity:25/85 - (29%)
Similarity:41/85 - (48%) Gaps:19/85 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 MRSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNL-- 77
            |..|:|||:....||.:|::.|...|.|.|:.:     :.:|.|:.|.:::|...|..|:|.|  
plant     1 MSRVYVGNLDPRVTERELEDEFRAFGVVRSVWV-----ARRPPGYAFLDFEDPRDARDAIRALDG 60

  Fly    78 -NGYEI-----------GGR 85
             ||:.:           |||
plant    61 KNGWRVEQSHNRGERGGGGR 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 25/85 (29%)
CSTF2_hinge 111..190 CDD:433869
CSTF_C 377..416 CDD:464130
RSZ22NP_194886.1 RRM_SRSF3_like 3..71 CDD:409808 21/72 (29%)
zf-CCHC 100..114 CDD:395050
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.