DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and PHIP1

DIOPT Version :10

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_191094.1 Gene:PHIP1 / 824700 AraportID:AT3G55340 Length:597 Species:Arabidopsis thaliana


Alignment Length:99 Identity:26/99 - (26%)
Similarity:55/99 - (55%) Gaps:13/99 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNLNGYEI 82
            |::||:.::.||..::::||:. .:.|::|..::|:|:.||:...::||..:...|:: |:...|
plant   264 VYIGNLAWDTTERDIRKLFSDC-VINSVRLGKNKETGEFKGYAHVDFKDSVSVAIALK-LDQQVI 326

  Fly    83 GGRTLRVDNACTEKSRMEMQQLLQGPQVENPYGE 116
            .||.:::  .|..|.|         |..::..||
plant   327 CGRPVKI--CCALKDR---------PATDHTPGE 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 20/75 (27%)
CSTF2_hinge 111..190 CDD:433869 2/6 (33%)
CSTF_C 377..416 CDD:464130
PHIP1NP_191094.1 RRM1_PHIP1 163..234 CDD:409714
RRM2_PHIP1 263..334 CDD:409715 20/73 (27%)
PTZ00368 393..592 CDD:173561
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.