DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and AT3G47120

DIOPT Version :10

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_190296.1 Gene:AT3G47120 / 823865 AraportID:AT3G47120 Length:352 Species:Arabidopsis thaliana


Alignment Length:88 Identity:35/88 - (39%)
Similarity:55/88 - (62%) Gaps:0/88 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KSMRSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNL 77
            |:...|:||.||::.||..|..:||:.|.::.:.|:.|:.:||.|||.|..|:||.:.:.|:.||
plant    33 KNSAYVYVGGIPFDLTEGDLLAVFSQYGEIVDVNLIRDKGTGKSKGFAFLAYEDQRSTILAVDNL 97

  Fly    78 NGYEIGGRTLRVDNACTEKSRME 100
            ||..:.|||::||:....|...|
plant    98 NGALVLGRTIKVDHCGAYKKHEE 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 33/80 (41%)
CSTF2_hinge 111..190 CDD:433869
CSTF_C 377..416 CDD:464130
AT3G47120NP_190296.1 RRM_ist3_like 27..115 CDD:409845 33/81 (41%)
PABP-1234 38..>310 CDD:130689 34/83 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.