DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and GRP4

DIOPT Version :10

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_189025.1 Gene:GRP4 / 821966 AraportID:AT3G23830 Length:136 Species:Arabidopsis thaliana


Alignment Length:80 Identity:28/80 - (35%)
Similarity:51/80 - (63%) Gaps:1/80 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNLNGYEI 82
            :|||.:.:...:..||:.|:..|.|....::.|||:|:.:||||..:..:::|.:|::.::|.|:
plant    37 LFVGGLSWGTDDSSLKQAFTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAIKEMDGKEL 101

  Fly    83 GGRTLRVDNACTEKS 97
            .||.:|| |..||:|
plant   102 NGRQIRV-NLATERS 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 25/75 (33%)
CSTF2_hinge 111..190 CDD:433869
CSTF_C 377..416 CDD:464130
GRP4NP_189025.1 PLN03134 1..122 CDD:178680 28/80 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.