DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and AT3G06970

DIOPT Version :10

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_187353.2 Gene:AT3G06970 / 819882 AraportID:AT3G06970 Length:317 Species:Arabidopsis thaliana


Alignment Length:124 Identity:33/124 - (26%)
Similarity:54/124 - (43%) Gaps:20/124 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DKSMRSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRN 76
            |..:..:||||:.:..|.:.|:..|.:.|.|:...:|.:...|:.||:||..::|..:.:.|::|
plant     8 DTRVTKIFVGNLTWRTTADDLRRYFEQFGQVVDANVVSETYPGRSKGYGFITFRDYVSTVRALQN 72

  Fly    77 LNGYEIGGRTLRVDNACTEKSRMEM---------------QQLLQGPQVENPYGEPCEP 120
            .... |.|||... |..:..::..|               .|..|.||...||   |.|
plant    73 SKPI-IDGRTTNC-NLASAGAKQNMNHPNLNGSFNYVIPPHQYQQAPQHVIPY---CPP 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 24/81 (30%)
CSTF2_hinge 111..190 CDD:433869 4/10 (40%)
CSTF_C 377..416 CDD:464130
AT3G06970NP_187353.2 PABP-1234 <3..182 CDD:130689 33/124 (27%)
RRM_SF 12..87 CDD:473069 23/76 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.