DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and ncl

DIOPT Version :10

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001070120.3 Gene:ncl / 767714 ZFINID:ZDB-GENE-030131-6986 Length:704 Species:Danio rerio


Alignment Length:122 Identity:31/122 - (25%)
Similarity:65/122 - (53%) Gaps:29/122 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADKAQEQ---------SIM-----DKSMRS----------VFVGNIPYEATEEKLKEIFSEVGP 41
            :|:||.|:         ||:     |||.:.          :.|.|:.:.|:|:.|:.:|.:   
Zfish   425 IAEKALEEAQGSDVQGRSIIVDFTGDKSRQGGRGAPSASKVLVVNNLAFSASEDSLQSVFEK--- 486

  Fly    42 VLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNLNGYEIGGRTLRVDNACTEKSR 98
            .:|:::  .:.:|:|||:.|.|:::.|.:..|:.|.|..:|.||::|::.:..::.|
Zfish   487 AVSIRI--PQNNGRPKGYAFVEFENVEDSKEALENCNNTDIEGRSIRLEYSQNDRER 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 25/98 (26%)
CSTF2_hinge 111..190 CDD:433869
CSTF_C 377..416 CDD:464130
nclNP_001070120.3 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.