DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and Snrnp35

DIOPT Version :9

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_083808.1 Gene:Snrnp35 / 76167 MGIID:1923417 Length:244 Species:Mus musculus


Alignment Length:107 Identity:32/107 - (29%)
Similarity:55/107 - (51%) Gaps:8/107 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADKAQEQSIMDKSMRSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYK 65
            :|.....:.:....:.::||..:..:..||||||:||..|.:..|:||.|..:|..||:.|.|||
Mouse    36 LARYVPNKGVTGDPLLTLFVARLNLQTKEEKLKEVFSRYGDIRRLRLVRDLVTGFSKGYAFIEYK 100

  Fly    66 DQETALSAMRNLNGYEIGGRTLRVDNACTEKSRMEMQQLLQG 107
            ::...:.|.|:.:|..|....:.||        .|:::.|:|
Mouse   101 EERALMKAYRDADGLVIDQHEIFVD--------YELERTLRG 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM <13..>112 CDD:223796 31/95 (33%)
RRM_CSTF2_CSTF2T 18..92 CDD:241115 28/73 (38%)
CSTF2_hinge 112..190 CDD:291025
CSTF_C 377..416 CDD:291002
Snrnp35NP_083808.1 RRM_snRNP35 48..137 CDD:240683 31/95 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..244
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.