DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and TIA1

DIOPT Version :9

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_071505.2 Gene:TIA1 / 7072 HGNCID:11802 Length:386 Species:Homo sapiens


Alignment Length:313 Identity:71/313 - (22%)
Similarity:117/313 - (37%) Gaps:99/313 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KAQEQSIMDKSMRS-----VFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCE 63
            |....|.:..:.||     ||||::..|.|.|.:|..|:..|.:...::|.|..:||.||:||..
Human    89 KDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVS 153

  Fly    64 YKDQETALSAMRNLNGYEIGGRTLRVDNACTE----KSRME------------------------ 100
            :.::..|.:|::.:.|..:|||.:|.:.|..:    ||..|                        
Human   154 FFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYC 218

  Fly   101 -------MQQLLQGPQVENPYGEPCEPEDAPELITKTVASLPPEQMYELMKQMKLCIVSNPSEAR 158
                   .:||::  |..:|:|:..|            ..:.|::.|..::     ..|:.|.|.
Human   219 GGVTSGLTEQLMR--QTFSPFGQIME------------IRVFPDKGYSFVR-----FNSHESAAH 264

  Fly   159 QMLMLNPQLAYALLQAMVV--------MRIVDPQQALGMLFKANQMP-PVLGGNPHQGPGNHTMM 214
            .::.:|.    ..::..||        :.:::|.|      :.||:. |...|...|..||...:
Human   265 AIVSVNG----TTIEGHVVKCYWGKETLDMINPVQ------QQNQIGYPQPYGQWGQWYGNAQQI 319

  Fly   215 GQQ-----QVPQ--------QQVQIPQQQQQAP--------QPPMPVPGPGFP 246
            ||.     |||.        .|....|.|..||        |||....|...|
Human   320 GQYMPNGWQVPAYGMYGQAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM <13..>112 CDD:223796 34/138 (25%)
RRM_CSTF2_CSTF2T 18..92 CDD:241115 25/73 (34%)
CSTF2_hinge 112..190 CDD:291025 13/85 (15%)
CSTF_C 377..416 CDD:291002
TIA1NP_071505.2 RRM1_TIA1 8..81 CDD:410027
RRM2_TIA1 104..181 CDD:410030 25/76 (33%)
RRM3_TIAR 214..286 CDD:241064 14/94 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 354..386 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.