DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and Srsf1

DIOPT Version :9

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001103022.1 Gene:Srsf1 / 689890 RGDID:1587490 Length:248 Species:Rattus norvegicus


Alignment Length:73 Identity:22/73 - (30%)
Similarity:41/73 - (56%) Gaps:3/73 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNLNGYEI 82
            ::|||:|.:...:.::::|.:.|.:..:.|. :|..|.|  |.|.|::|...|..|:...:||:.
  Rat    18 IYVGNLPPDIRTKDIEDVFYKYGAIRDIDLK-NRRGGPP--FAFVEFEDPRDAEDAVYGRDGYDY 79

  Fly    83 GGRTLRVD 90
            .|..|||:
  Rat    80 DGYRLRVE 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM <13..>112 CDD:223796 22/73 (30%)
RRM_CSTF2_CSTF2T 18..92 CDD:241115 22/73 (30%)
CSTF2_hinge 112..190 CDD:291025
CSTF_C 377..416 CDD:291002
Srsf1NP_001103022.1 RRM1_SRSF1 12..90 CDD:410010 22/73 (30%)
RRM2_SRSF1 113..196 CDD:410160
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.