DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and cirbpb

DIOPT Version :10

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001035411.2 Gene:cirbpb / 678563 ZFINID:ZDB-GENE-030131-5841 Length:206 Species:Danio rerio


Alignment Length:75 Identity:29/75 - (38%)
Similarity:50/75 - (66%) Gaps:0/75 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNLNGYEI 82
            :|:|.:.|:.||:.|:|.||:.|.:..:.::.|||:.:.:||||..:::.|.|..||..:||.::
Zfish     7 LFIGGLSYDTTEQSLEEAFSKYGTIAKVDVIRDRETDRSRGFGFVTFENPEDAKDAMAAMNGKQV 71

  Fly    83 GGRTLRVDNA 92
            .||.:|||.|
Zfish    72 DGRMIRVDEA 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 29/75 (39%)
CSTF2_hinge 111..190 CDD:433869
CSTF_C 377..416 CDD:464130
cirbpbNP_001035411.2 RRM_CIRBP_RBM3 5..83 CDD:409883 29/75 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.