DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and SNRNP70

DIOPT Version :9

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_003080.2 Gene:SNRNP70 / 6625 HGNCID:11150 Length:437 Species:Homo sapiens


Alignment Length:98 Identity:31/98 - (31%)
Similarity:55/98 - (56%) Gaps:3/98 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADKAQEQSIMDKSMRSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYK 65
            |.|...:.:....:.:::||..:.|:.||.||:..|...||:..:.:|:.:.||||:|:.|.||:
Human    88 MWDPHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYE 152

  Fly    66 DQETALSAMRNLNGYEIGGRTLRVDNACTEKSR 98
            .:....||.::.:|.:|.||.:.||   .|:.|
Human   153 HERDMHSAYKHADGKKIDGRRVLVD---VERGR 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM <13..>112 CDD:223796 29/86 (34%)
RRM_CSTF2_CSTF2T 18..92 CDD:241115 27/73 (37%)
CSTF2_hinge 112..190 CDD:291025
CSTF_C 377..416 CDD:291002
SNRNP70NP_003080.2 U1snRNP70_N 3..93 CDD:403437 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..79
Required for interaction with U1 RNA. /evidence=ECO:0000269|PubMed:2467746 92..202 29/94 (31%)
RRM_snRNP70 102..187 CDD:409682 29/84 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..437
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.