DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and TRA2B

DIOPT Version :10

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_004584.1 Gene:TRA2B / 6434 HGNCID:10781 Length:288 Species:Homo sapiens


Alignment Length:97 Identity:30/97 - (30%)
Similarity:51/97 - (52%) Gaps:14/97 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SMRSVFVGN--------------IPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEY 64
            |.|...|||              :....||..|:|:||:.||:..:.:|:|::|.:.:||.|..:
Human   102 STRRRHVGNRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYF 166

  Fly    65 KDQETALSAMRNLNGYEIGGRTLRVDNACTEK 96
            ::.:.|..|....||.|:.||.:|||.:.|::
Human   167 ENVDDAKEAKERANGMELDGRRIRVDFSITKR 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 29/93 (31%)
CSTF2_hinge 111..190 CDD:433869
CSTF_C 377..416 CDD:464130
TRA2BNP_004584.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..114 5/11 (45%)
RRM_TRA2 117..196 CDD:409798 24/78 (31%)
Linker 193..230 1/6 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 196..225 1/3 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..288
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.