DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and SRSF7

DIOPT Version :10

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001026854.1 Gene:SRSF7 / 6432 HGNCID:10789 Length:238 Species:Homo sapiens


Alignment Length:107 Identity:31/107 - (28%)
Similarity:50/107 - (46%) Gaps:17/107 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNLNGYEI 82
            |:|||:...|.:.:|:..||..||:.::.:     :..|.||.|.|::|...|..|:|.|:|..|
Human    13 VYVGNLGTGAGKGELERAFSYYGPLRTVWI-----ARNPPGFAFVEFEDPRDAEDAVRGLDGKVI 72

  Fly    83 GGRTLRVD--NACTEKSRMEMQQLLQGPQVENPYGEPCEPED 122
            .|..:||:  .....:||.:          ..|...|.:|.|
Human    73 CGSRVRVELSTGMPRRSRFD----------RPPARRPFDPND 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 25/77 (32%)
CSTF2_hinge 111..190 CDD:433869 4/12 (33%)
CSTF_C 377..416 CDD:464130
SRSF7NP_001026854.1 RRM_SRSF7 12..88 CDD:410050 25/79 (32%)
Sufficient for interaction with NXF1 81..98 3/26 (12%)
zf-CCHC 104..119 CDD:395050 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 123..238
6 X 8 AA repeats of R-R-S-R-S-X-S-X 153..226
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.