DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and Srsf4

DIOPT Version :9

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001356237.1 Gene:Srsf4 / 57317 MGIID:1890577 Length:496 Species:Mus musculus


Alignment Length:57 Identity:16/57 - (28%)
Similarity:27/57 - (47%) Gaps:13/57 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 FGFCEYKDQETALSAMRNLNGYEIGGRTLRVDNACTEKSRMEMQQLLQGPQVENPYG 115
            :||.|:.|...|..|:..|||.::.|..:.|::|             :||:.:..||
Mouse    42 YGFVEFDDLRDADDAVYELNGKDLCGERVIVEHA-------------RGPRRDGSYG 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM <13..>112 CDD:223796 14/52 (27%)
RRM_CSTF2_CSTF2T 18..92 CDD:241115 11/32 (34%)
CSTF2_hinge 112..190 CDD:291025 2/4 (50%)
CSTF_C 377..416 CDD:291002
Srsf4NP_001356237.1 RRM_SF <42..77 CDD:388407 12/47 (26%)
RRM2_SRSF4_like 109..180 CDD:241044
U2AF_lg 250..>361 CDD:273727
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.