DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CstF64 and snrnp35

DIOPT Version :9

Sequence 1:	NP_477453.1	Gene:	CstF64 / 42239	FlyBaseID:	FBgn0027841	Length:	419	Species:	Drosophila melanogaster
Sequence 2:	NP_001025412.1	Gene:	snrnp35 / 569999	ZFINID:	ZDB-GENE-050706-77	Length:	208	Species:	Danio rerio

Alignment Length:	91	Identity:	29/91 - (31%)
Similarity:	49/91 - (53%)	Gaps:	8/91 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly    17 SVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNLNGYE 81
            ::||..:..:.|||||:::||:.|.:..|:||.|..:|..|.:.|.|||::.:...|.|:.|...
Zfish    51 TLFVARLNPQTTEEKLRDVFSKFGDIRRLRLVRDVVTGFSKRYAFIEYKEERSLKRAWRDANKLI 115

  Fly    82 IGGRTLRVDNACTEKSRMEMQQLLQG 107
            :....|.||        :|.::.|.|
Zfish   116 LDQYELLVD--------VEQERTLPG 133

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CstF64	NP_477453.1	RRM	<13..>112	CDD:223796	29/91 (32%)
		RRM_CSTF2_CSTF2T	18..92	CDD:241115	26/73 (36%)
		CSTF2_hinge	112..190	CDD:291025
		CSTF_C	377..416	CDD:291002
snrnp35	NP_001025412.1	RRM	<47..>172	CDD:223796	29/91 (32%)
		RRM_snRNP35	47..139	CDD:240683	29/91 (32%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	133..208		1/1 (100%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910