DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CstF64 and hnrnpm

DIOPT Version :9

Sequence 1:	NP_477453.1	Gene:	CstF64 / 42239	FlyBaseID:	FBgn0027841	Length:	419	Species:	Drosophila melanogaster
Sequence 2:	XP_005170511.1	Gene:	hnrnpm / 555643	ZFINID:	ZDB-GENE-030131-6898	Length:	715	Species:	Danio rerio

Alignment Length:	77	Identity:	29/77 - (37%)
Similarity:	45/77 - (58%)	Gaps:	8/77 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly    18 VFVGNIPYEATEEKLKEIFSEVGPV--LSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNLNGY 80
            :||.|:|::.|.:.||:.|:..|.|  ..:|:    |:||.||.|...:.:.|||..|.|.:|||
Zfish   640 IFVRNLPFDFTWKMLKDTFNSCGMVQYADIKM----ENGKSKGCGVVRFDNPETAERACRTMNGY 700

  Fly    81 EIGGRTL--RVD 90
            .:.||.:  |:|
Zfish   701 RLNGREIDVRID 712

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CstF64	NP_477453.1	RRM	<13..>112	CDD:223796	29/77 (38%)
		RRM_CSTF2_CSTF2T	18..92	CDD:241115	29/77 (38%)
		CSTF2_hinge	112..190	CDD:291025
		CSTF_C	377..416	CDD:291002
hnrnpm	XP_005170511.1	RRM	<19..>122	CDD:223796
		HnRNP_M	20..47	CDD:288396
		RRM1_hnRNPM	49..124	CDD:241101
		RRM	<215..>309	CDD:223796
		RRM2_hnRNPM	233..308	CDD:241103
		RRM3_hnRNPM	639..715	CDD:241105	29/77 (38%)
		RRM	<640..>715	CDD:223796	29/77 (38%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0724
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900