DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and LOC4576768

DIOPT Version :10

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:XP_001237856.3 Gene:LOC4576768 / 4576768 VectorBaseID:AGAMI1_002317 Length:361 Species:Anopheles gambiae


Alignment Length:65 Identity:21/65 - (32%)
Similarity:36/65 - (55%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AQEQSIMDKSMRSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQET 69
            :..||......|.:|||.:.:|.||:.|:|.|.:.|.:.|:.:..|..:|:.:||.|..||..::
Mosquito    57 SDSQSNARDDERKLFVGGLSWETTEKDLREHFGQYGEIESINVKTDPNTGRSRGFAFIVYKASDS 121

  Fly    70  69
            Mosquito   122  121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 19/60 (32%)
CSTF2_hinge 111..190 CDD:433869
CSTF_C 377..416 CDD:464130
LOC4576768XP_001237856.3 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.