DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and B52

DIOPT Version :9

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster


Alignment Length:155 Identity:33/155 - (21%)
Similarity:56/155 - (36%) Gaps:45/155 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNLNGYEI 82
            |:||.:||...|..|:..|...|....:.:        ..|:||.|::|...|..|:..|||.|:
  Fly     6 VYVGGLPYGVRERDLERFFKGYGRTRDILI--------KNGYGFVEFEDYRDADDAVYELNGKEL 62

  Fly    83 GGRTLRVDNA--------------------------CTEKSRMEMQQLLQGPQVENPYGEPCEPE 121
            .|..:.|:.|                          ..||::........||.:...|       
  Fly    63 LGERVVVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTEY------- 120

  Fly   122 DAPELITKTVAS-LPPEQMYELMKQ 145
               .||.:.::| :..:.:.:.|:|
  Fly   121 ---RLIVENLSSRVSWQDLKDYMRQ 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM <13..>112 CDD:223796 27/119 (23%)
RRM_CSTF2_CSTF2T 18..92 CDD:241115 22/73 (30%)
CSTF2_hinge 112..190 CDD:291025 6/35 (17%)
CSTF_C 377..416 CDD:291002
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 23/75 (31%)
RRM2_SRSF4_like 120..191 CDD:241044 6/33 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.