DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and Rbp1

DIOPT Version :10

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster


Alignment Length:73 Identity:22/73 - (30%)
Similarity:42/73 - (57%) Gaps:5/73 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNLNGYEI 82
            |:|||:...|::.:::..|::.||:.::.:     :..|.||.|.|::|:..|..|.|.|:|...
  Fly    13 VYVGNLGSSASKHEIEGAFAKYGPLRNVWV-----ARNPPGFAFVEFEDRRDAEDATRALDGTRC 72

  Fly    83 GGRTLRVD 90
            .|..:||:
  Fly    73 CGTRIRVE 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 22/73 (30%)
CSTF2_hinge 111..190 CDD:433869
CSTF_C 377..416 CDD:464130
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 22/73 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.