DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and rump

DIOPT Version :10

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster


Alignment Length:86 Identity:34/86 - (39%)
Similarity:53/86 - (61%) Gaps:3/86 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AQEQSIMDKSMRSVFVGNIPYEATEEKLKEIFSE-VGPVLSLKLVFDRESGKPKGFGFCEYKDQE 68
            |:::|...::.| |::.||||:...:.||::|.. ||.:..::|.|| ||||.:|.|..|:||.|
  Fly    47 ARDRSRERRNCR-VYISNIPYDYRWQDLKDLFRRIVGSIEYVQLFFD-ESGKARGCGIVEFKDPE 109

  Fly    69 TALSAMRNLNGYEIGGRTLRV 89
            ....|:..:|.||:.||.|.|
  Fly   110 NVQKALEKMNRYEVNGRELVV 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 32/81 (40%)
CSTF2_hinge 111..190 CDD:433869
CSTF_C 377..416 CDD:464130
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 33/85 (39%)
RRM1_hnRNPM_like 58..133 CDD:409819 32/75 (43%)
RRM2_hnRNPM_like 234..307 CDD:409820
RRM_SF 565..629 CDD:473069
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.