DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and pabpn1

DIOPT Version :10

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001001230.1 Gene:pabpn1 / 407911 XenbaseID:XB-GENE-1007049 Length:296 Species:Xenopus tropicalis


Alignment Length:79 Identity:27/79 - (34%)
Similarity:48/79 - (60%) Gaps:1/79 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 MDKSMRSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMR 75
            |:...||::|||:.|.||.|:|:..|...|.|..:.::.|:.:|.||||.:.|:.|:|:..:::.
 Frog   158 MEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKYTGHPKGFAYIEFSDKESVRTSLA 222

  Fly    76 NLNGYEIGGRTLRV 89
             |:.....||.::|
 Frog   223 -LDESLFRGRQIKV 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 27/79 (34%)
CSTF2_hinge 111..190 CDD:433869
CSTF_C 377..416 CDD:464130
pabpn1NP_001001230.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..102
Necessary for homooligomerization. /evidence=ECO:0000250|UniProtKB:Q86U42 146..296 27/79 (34%)
RRM_II_PABPN1 164..239 CDD:409966 25/73 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.