DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and Rsf1

DIOPT Version :10

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_477001.2 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster


Alignment Length:82 Identity:26/82 - (31%)
Similarity:46/82 - (56%) Gaps:5/82 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SIMDKSMRSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSA 73
            |:.|:....|:|||:..:..::.|:..|::.|.:.|:.:.|:     |.||.|.|::.::.|..|
  Fly     3 SMGDQRGTRVYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFN-----PPGFAFVEFEHRDDAEKA 62

  Fly    74 MRNLNGYEIGGRTLRVD 90
            ...|||.|:.|..|||:
  Fly    63 CDILNGSELLGSQLRVE 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 25/81 (31%)
CSTF2_hinge 111..190 CDD:433869
CSTF_C 377..416 CDD:464130
Rsf1NP_477001.2 RRM_SRSF3_like 11..82 CDD:409808 24/74 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.