DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and snRNP-U1-70K

DIOPT Version :9

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001260173.1 Gene:snRNP-U1-70K / 33982 FlyBaseID:FBgn0016978 Length:448 Species:Drosophila melanogaster


Alignment Length:96 Identity:30/96 - (31%)
Similarity:56/96 - (58%) Gaps:3/96 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DKAQEQSIMDKSMRSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQ 67
            |..:.::..:...|::|:..|.|:.:|.||:..|...||:..:.|:.|:|||||||:.|.||:.:
  Fly    89 DPTEIKNATEDPFRTLFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHE 153

  Fly    68 ETALSAMRNLNGYEIGGRTLRVDNACTEKSR 98
            ....:|.::.:|.:|..:.:.||   .|::|
  Fly   154 RDMHAAYKHADGKKIDSKRVLVD---VERAR 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM <13..>112 CDD:223796 29/86 (34%)
RRM_CSTF2_CSTF2T 18..92 CDD:241115 26/73 (36%)
CSTF2_hinge 112..190 CDD:291025
CSTF_C 377..416 CDD:291002
snRNP-U1-70KNP_001260173.1 U1snRNP70_N 2..92 CDD:289024 1/2 (50%)
RRM <97..>179 CDD:223796 27/84 (32%)
RRM_snRNP70 101..188 CDD:240682 29/84 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1455080at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.