DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and srsf5a

DIOPT Version :9

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_957161.1 Gene:srsf5a / 335396 ZFINID:ZDB-GENE-030131-7336 Length:259 Species:Danio rerio


Alignment Length:147 Identity:33/147 - (22%)
Similarity:61/147 - (41%) Gaps:34/147 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNLNGYEI 82
            ||:|.:...|.|..:::.|...|.:        ||.....||||.|:.|...|..|:..|||.|:
Zfish     6 VFIGRLSPHARERDVEKFFKGYGRI--------REINLKNGFGFVEFDDYRDADDAVYELNGKEL 62

  Fly    83 GGRTLRVDNACTEKSRMEMQQLLQGPQV-----------------ENPYGEPCEPEDAPELITKT 130
            ....:.:::|.:.:.|.      .||.:                 .:.||.|...|.  .:|.:.
Zfish    63 CSERVTIEHARSRRGRG------GGPGMGGRFSPRFGGYRQSRSGGSRYGPPVRTEH--RIIVEN 119

  Fly   131 VAS-LPPEQMYELMKQM 146
            ::| :..:.:.:||:::
Zfish   120 LSSRISWQDLKDLMRKV 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM <13..>112 CDD:223796 25/110 (23%)
RRM_CSTF2_CSTF2T 18..92 CDD:241115 21/73 (29%)
CSTF2_hinge 112..190 CDD:291025 8/36 (22%)
CSTF_C 377..416 CDD:291002
srsf5aNP_957161.1 RRM1_SRSF4_like 5..72 CDD:240783 21/73 (29%)
RRM2_SRSF4_like 113..184 CDD:241044 4/26 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.