DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and U2af50

DIOPT Version :9

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001245708.1 Gene:U2af50 / 32602 FlyBaseID:FBgn0005411 Length:427 Species:Drosophila melanogaster


Alignment Length:158 Identity:38/158 - (24%)
Similarity:66/158 - (41%) Gaps:33/158 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SIMDKSMRSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSA 73
            :::..|...:|:|.:|....::::||:....|.:.:..||.|..:|..||:.||||.|......:
  Fly   211 TVVPDSPHKIFIGGLPNYLNDDQVKELLLSFGKLRAFNLVKDAATGLSKGYAFCEYVDLSITDQS 275

  Fly    74 MRNLNGYEIGGRTLRVDNA------CTEKSRMEMQQLLQGPQVENPYGEPCEPEDAPELITKTVA 132
            :..|||.::|.:.|.|..|      ....:......:||.|.:.|                 .|.
  Fly   276 IAGLNGMQLGDKKLIVQRASVGAKNAQNAANTTQSVMLQVPGLSN-----------------VVT 323

  Fly   133 SLPPEQMYELMKQMKLCIVS--NPSEAR 158
            |.||.::        ||:::  .|.|.|
  Fly   324 SGPPTEV--------LCLLNMVTPDELR 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM <13..>112 CDD:223796 28/104 (27%)
RRM_CSTF2_CSTF2T 18..92 CDD:241115 23/73 (32%)
CSTF2_hinge 112..190 CDD:291025 10/49 (20%)
CSTF_C 377..416 CDD:291002
U2af50NP_001245708.1 RRM1_U2AF65 103..184 CDD:240676
RRM2_U2AF65 218..294 CDD:240677 23/75 (31%)
RRM3_U2AF65 328..415 CDD:240678 5/24 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451801
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.