DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and HNRNPAB

DIOPT Version :10

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_112556.2 Gene:HNRNPAB / 3182 HGNCID:5034 Length:332 Species:Homo sapiens


Alignment Length:66 Identity:22/66 - (33%)
Similarity:40/66 - (60%) Gaps:0/66 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DKAQEQSIMDKSMRSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQ 67
            |..:..::....::.:|||.:..||||||::|.|.|.|.:.:::|..|.:..|.:||.|..:|::
Human   141 DPKKAMAMKKDPVKKIFVGGLNPEATEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEE 205

  Fly    68 E 68
            |
Human   206 E 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 21/59 (36%)
CSTF2_hinge 111..190 CDD:433869
CSTF_C 377..416 CDD:464130
HNRNPABNP_112556.2 CBFNT 1..70 CDD:311868
RRM1_hnRNPAB 66..145 CDD:410151 1/3 (33%)
RRM2_hnRNPAB 150..229 CDD:409997 21/57 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.