DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and Rbm8a

DIOPT Version :10

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001258067.1 Gene:Rbm8a / 295284 RGDID:1310099 Length:174 Species:Rattus norvegicus


Alignment Length:93 Identity:31/93 - (33%)
Similarity:49/93 - (52%) Gaps:5/93 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DKAQEQSIMDKSMRSV-----FVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFC 62
            |..::........|||     ||..:..|||||.:.:.|:|.|.:.::.|..||.:|..||:...
  Rat    55 DSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLV 119

  Fly    63 EYKDQETALSAMRNLNGYEIGGRTLRVD 90
            ||:..:.|.:||..|||.::.|:.:.||
  Rat   120 EYETYKEAQAAMEGLNGQDLMGQPISVD 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 30/86 (35%)
CSTF2_hinge 111..190 CDD:433869
CSTF_C 377..416 CDD:464130
Rbm8aNP_001258067.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70 2/14 (14%)
RRM_RBM8 67..151 CDD:409762 30/81 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..174
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.