DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and Uhmk1

DIOPT Version :10

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_058989.1 Gene:Uhmk1 / 246332 RGDID:2968 Length:419 Species:Rattus norvegicus


Alignment Length:61 Identity:21/61 - (34%)
Similarity:30/61 - (49%) Gaps:3/61 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 YEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNLNGYEIGGR 85
            ||...|.:||...:.|||:|| ||.....|  :|..|.||.:...:.:|.:.|.|....|:
  Rat   340 YEDVVEDVKEECQKYGPVVSL-LVPKENPG--RGQVFVEYANAGDSKAAQKLLTGRMFDGK 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 21/61 (34%)
CSTF2_hinge 111..190 CDD:433869
CSTF_C 377..416 CDD:464130
Uhmk1NP_058989.1 STKc_KIS 22..308 CDD:270922
RRM_UHMK1 318..405 CDD:409898 21/61 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.