DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and Tia1

DIOPT Version :9

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_035715.1 Gene:Tia1 / 21841 MGIID:107914 Length:386 Species:Mus musculus


Alignment Length:307 Identity:72/307 - (23%)
Similarity:118/307 - (38%) Gaps:99/307 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KAQEQSIMDKSMRS-----VFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCE 63
            |....|.:..:.||     ||||::..|.|.|.:|..|:..|.:...::|.|..:||.||:||..
Mouse    89 KDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVS 153

  Fly    64 YKDQETALSAMRNLNGYEIGGRTLRVDNACTE----KSRME------------------------ 100
            :.::..|.:|::.:.|..:|||.:|.:.|..:    ||..|                        
Mouse   154 FFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVSQSSPNNCTVYC 218

  Fly   101 -------MQQLLQGPQVENPYGEPCEPEDAPELITKTVASLPPEQMYELMKQMKLCIVSNPSEAR 158
                   .:||::  |..:|:|:..|            ..:.|::.|..::     ..|:.|.|.
Mouse   219 GGVTSGLTEQLMR--QTFSPFGQIME------------IRVFPDKGYSFVR-----FSSHESAAH 264

  Fly   159 QMLMLNPQLAYALLQAMVV--------MRIVDPQQALGMLFKANQM--PPVLG--GNPHQGPGNH 211
            .::.:|.    ..::..||        :.:::|.|      :.||:  ||..|  |   |..||.
Mouse   265 AIVSVNG----TTIEGHVVKCYWGKETLDMINPVQ------QQNQIGYPPTYGQWG---QWYGNA 316

  Fly   212 TMMGQQ-----QVPQ--------QQVQIPQQQQQAP--QPPMPVPGP 243
            ..:||.     |||.        .|....|.|..||  .|...||.|
Mouse   317 QQIGQYVPNGWQVPAYGVYGQPWSQQGFNQTQSSAPWMGPNYSVPPP 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM <13..>112 CDD:223796 34/138 (25%)
RRM_CSTF2_CSTF2T 18..92 CDD:241115 25/73 (34%)
CSTF2_hinge 112..190 CDD:291025 13/85 (15%)
CSTF_C 377..416 CDD:291002
Tia1NP_035715.1 ELAV_HUD_SF 6..280 CDD:273741 46/213 (22%)
RRM1_TIA1 8..81 CDD:241059
RRM2_TIA1 105..184 CDD:241062 26/78 (33%)
RRM3_TIA1 214..287 CDD:241065 14/95 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..376 4/9 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.