DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and Rbm4

DIOPT Version :10

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_033058.2 Gene:Rbm4 / 19653 MGIID:1100865 Length:361 Species:Mus musculus


Alignment Length:144 Identity:37/144 - (25%)
Similarity:65/144 - (45%) Gaps:47/144 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 MRSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNLNG 79
            |..:|:||:|.||||::::.:|.:.|.||...::        |.:||...:|:..|..|:|||:.
Mouse     1 MVKLFIGNLPREATEQEIRSLFEQYGKVLECDII--------KNYGFVHIEDKTAAEDAIRNLHH 57

  Fly    80 YEIGGRTLRVDNA------------------CT-EKSRMEMQQLLQGPQVENPYGEPCE------ 119
            |::.|..:.|:.:                  || ::.|.:.::  .||.:|      |:      
Mouse    58 YKLHGVNINVEASKNKSKASTKLHVGNISPTCTNQELRAKFEE--YGPVIE------CDIVKDYA 114

  Fly   120 ------PEDAPELI 127
                  .|||.|.|
Mouse   115 FVHMERAEDAVEAI 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 25/96 (26%)
CSTF2_hinge 111..190 CDD:433869 7/29 (24%)
CSTF_C 377..416 CDD:464130
Rbm4NP_033058.2 RRM1_RBM4 2..68 CDD:410018 23/73 (32%)
RRM2_RBM4 78..144 CDD:410019 12/59 (20%)
PTZ00368 <145..>181 CDD:173561
ZnF_C2HC 161..176 CDD:197667
Interaction with TNPO3. /evidence=ECO:0000250 196..361
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.