DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and Rbm3

DIOPT Version :10

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_058089.2 Gene:Rbm3 / 19652 MGIID:1099460 Length:154 Species:Mus musculus


Alignment Length:82 Identity:31/82 - (37%)
Similarity:49/82 - (59%) Gaps:0/82 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 MDKSMRSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMR 75
            |......:|||.:.:...|:.|::.||..||:..:.:|.|||:.:.:||||..:.:.|.|..|||
Mouse     1 MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASDAMR 65

  Fly    76 NLNGYEIGGRTLRVDNA 92
            .:||..:.||.:|||:|
Mouse    66 AMNGESLDGRQIRVDHA 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 31/82 (38%)
CSTF2_hinge 111..190 CDD:433869
CSTF_C 377..416 CDD:464130
Rbm3NP_058089.2 RRM_CIRBP_RBM3 6..85 CDD:409883 30/77 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.