DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and rnp-9

DIOPT Version :9

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001359585.1 Gene:rnp-9 / 182350 WormBaseID:WBGene00007396 Length:312 Species:Caenorhabditis elegans


Alignment Length:216 Identity:51/216 - (23%)
Similarity:89/216 - (41%) Gaps:52/216 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNLNGYEI 82
            ||||::..:.:.|.||..|::.|.|...|::.|.::.|.||:||..:.:::.|.:|:..:||..|
 Worm    89 VFVGDLSKDVSNELLKSTFTKFGEVSEAKVIRDVQTQKSKGYGFVSFPNKQNAENAIAGMNGKWI 153

  Fly    83 GGRTLRVD-----NACTEKSRMEMQQLLQGPQVEN----------------------PYGEPCEP 120
            |.|.:|.:     |:...:.::..:|:....:.:|                      .||:..|.
 Worm   154 GKRAVRTNWAARKNSEENRDKLTFEQVFNSTKADNTSVYVGNISQQTTDADLRDLFSTYGDIAEV 218

  Fly   121 EDAPELITKTVASLPPEQMYELMK-QMKLCIVSNPSEARQMLMLNPQL--AYALLQAMVVMRIVD 182
            .     |.||       |.|..:: :.|.|......|.....|...|:  ::...||:       
 Worm   219 R-----IFKT-------QRYAFVRYEKKECATKAIMEMNGKEMAGNQVRCSWGRTQAV------- 264

  Fly   183 PQQALGML---FKANQMPPVL 200
            |.|||..|   ..:..||.:|
 Worm   265 PNQALNPLPIDLSSLMMPTML 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM <13..>112 CDD:223796 27/98 (28%)
RRM_CSTF2_CSTF2T 18..92 CDD:241115 25/78 (32%)
CSTF2_hinge 112..190 CDD:291025 20/102 (20%)
CSTF_C 377..416 CDD:291002
rnp-9NP_001359585.1 RRM2_TIA1_like 88..162 CDD:240799 25/72 (35%)
RRM3_TIA1_like 189..260 CDD:240800 13/82 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.