DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and rnp-7

DIOPT Version :10

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_498565.2 Gene:rnp-7 / 176002 WormBaseID:WBGene00004390 Length:332 Species:Caenorhabditis elegans


Alignment Length:136 Identity:38/136 - (27%)
Similarity:65/136 - (47%) Gaps:20/136 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AQEQSIMDKSMRSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQET 69
            |:.....:...|::|||.|.||.:|.||:..|...|.:..|.:|.| |:|||:|:.|.||.|:..
 Worm    93 AENPRASEDPYRTLFVGRINYETSESKLRREFEAYGKIKKLTMVHD-EAGKPRGYAFIEYSDKAE 156

  Fly    70 ALSAMRNLNGYEIGGRTLRVD------------------NACTEKSRMEMQQLLQGPQVENPYGE 116
            ..:|.:..:|.::.|:.|.||                  ...|.|:| |.:.:::..::.:.:|.
 Worm   157 MHTAYKKADGIKVDGKRLVVDYERGRTQKTWLPRRLGGGKGDTRKTR-EAKSVIEEREIASGFGG 220

  Fly   117 PCEPED 122
            ..|..|
 Worm   221 GYEDRD 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 30/101 (30%)
CSTF2_hinge 111..190 CDD:433869 3/12 (25%)
CSTF_C 377..416 CDD:464130
rnp-7NP_498565.2 U1snRNP70_N 4..95 CDD:432406 1/1 (100%)
RRM_snRNP70 103..192 CDD:409682 30/89 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.