DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and rsp-4

DIOPT Version :10

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001379856.1 Gene:rsp-4 / 173915 WormBaseID:WBGene00004701 Length:196 Species:Caenorhabditis elegans


Alignment Length:75 Identity:22/75 - (29%)
Similarity:39/75 - (52%) Gaps:0/75 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 MRSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNLNG 79
            :.|:.:.|:.|:.|...|:..|...|.:..:.:..|:.|.:.|||||..:.::..|..|:...:|
 Worm    18 LTSLKIDNLSYQTTPNDLRRTFERYGDIGDVHIPRDKYSRQSKGFGFVRFYERRDAEHALDRTDG 82

  Fly    80 YEIGGRTLRV 89
            ..:.||.|||
 Worm    83 KLVDGRELRV 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 22/75 (29%)
CSTF2_hinge 111..190 CDD:433869
CSTF_C 377..416 CDD:464130
rsp-4NP_001379856.1 RRM_SRSF2_SRSF8 21..93 CDD:409751 21/72 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.