DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and rbm-3.2

DIOPT Version :9

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_493023.1 Gene:rbm-3.2 / 173071 WormBaseID:WBGene00011156 Length:85 Species:Caenorhabditis elegans


Alignment Length:76 Identity:33/76 - (43%)
Similarity:51/76 - (67%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNLNGYE 81
            ||:|||.|::.||:.|...||:.|.|.::::|.|||:|:|:||.|.|:.::..|..|:...||.:
 Worm     5 SVYVGNAPFQTTEDDLGNYFSQAGNVSNVRIVCDRETGRPRGFAFVEFTEEAAAQRAVDQFNGVD 69

  Fly    82 IGGRTLRVDNA 92
            ..||.|||:.|
 Worm    70 FNGRALRVNLA 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM <13..>112 CDD:223796 33/76 (43%)
RRM_CSTF2_CSTF2T 18..92 CDD:241115 31/73 (42%)
CSTF2_hinge 112..190 CDD:291025
CSTF_C 377..416 CDD:291002
rbm-3.2NP_493023.1 RRM_SF 7..81 CDD:388407 31/74 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001914
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100265
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2262
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.