DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CstF64 and rbm-3.1

DIOPT Version :10

Sequence 1:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_493022.1 Gene:rbm-3.1 / 173070 WormBaseID:WBGene00011155 Length:83 Species:Caenorhabditis elegans


Alignment Length:76 Identity:34/76 - (44%)
Similarity:54/76 - (71%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNLNGYE 81
            ||:|||.|::.|||:|...||.:|.:.::::|.|||:|:|:||.|.|:.::.:|..|:..:||.|
 Worm     6 SVYVGNAPFQTTEEELGNFFSSIGQINNVRIVCDRETGRPRGFAFIEFAEEGSAQRAVEQMNGAE 70

  Fly    82 IGGRTLRVDNA 92
            ..||.|||:.|
 Worm    71 FNGRPLRVNLA 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 34/76 (45%)
CSTF2_hinge 111..190 CDD:433869
CSTF_C 377..416 CDD:464130
rbm-3.1NP_493022.1 RRM 6..82 CDD:440488 34/76 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.