DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31224 and Zbtb44

DIOPT Version :9

Sequence 1:NP_001287396.1 Gene:CG31224 / 42237 FlyBaseID:FBgn0051224 Length:1784 Species:Drosophila melanogaster
Sequence 2:XP_006510278.1 Gene:Zbtb44 / 235132 MGIID:1925123 Length:616 Species:Mus musculus


Alignment Length:183 Identity:52/183 - (28%)
Similarity:76/183 - (41%) Gaps:39/183 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1600 AHSDKFDYAEPMECPMCKQIFAKTSIKAHMATHSTE-PQYDCAICSKSFSTKWNLKIHSWVHANR 1663
            ||:|..|..|.::.|.  |::...|      |.||| |.                       .|.
Mouse   361 AHADDDDRLENVQYPY--QLYIAPS------TSSTERPS-----------------------PNG 394

  Fly  1664 TAKPFKCEYCPKAFVRELDFKNHINAHKQIKPYTCEYCGCKFIRKYNYMRHRREHHGTKKFTCDQ 1728
            ..:||:|..|...|.|..:.|.|:..|..|||:.|:.||.||.|.|:...||.:|.|.:.|.|..
Mouse   395 PDRPFQCPTCGVRFTRIQNLKQHMLIHSGIKPFQCDCCGKKFTRAYSLKMHRLKHEGKRCFRCQI 459

  Fly  1729 CDKSF-----HRHYYLIEHRRMHTGERPFTCTICGKSSTTKTNHNKHLK-IHH 1775
            |..:|     ::|:..:. |.:....|.:.|..||...|...|...||: ::|
Mouse   460 CSATFTSFGEYKHHMRVS-RHIIRKPRIYECKTCGAMFTNSGNLIVHLRSLNH 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31224NP_001287396.1 C2H2 Zn finger 1466..1486 CDD:275368
C2H2 Zn finger 1494..1514 CDD:275368
zf-H2C2_2 1506..1531 CDD:290200
C2H2 Zn finger 1522..1542 CDD:275368
PHA00733 1527..1623 CDD:177301 7/22 (32%)
C2H2 Zn finger 1554..1573 CDD:275370
C2H2 Zn finger 1580..1599 CDD:275368
C2H2 Zn finger 1613..1632 CDD:275368 3/18 (17%)
COG5048 <1637..1780 CDD:227381 39/145 (27%)
C2H2 Zn finger 1640..1660 CDD:275368 0/19 (0%)
C2H2 Zn finger 1670..1690 CDD:275368 6/19 (32%)
C2H2 Zn finger 1698..1718 CDD:275368 9/19 (47%)
zf-H2C2_2 1710..1735 CDD:290200 8/29 (28%)
C2H2 Zn finger 1726..1746 CDD:275368 5/24 (21%)
zf-H2C2_2 1738..1763 CDD:290200 5/24 (21%)
C2H2 Zn finger 1754..1774 CDD:275368 7/20 (35%)
Zbtb44XP_006510278.1 BTB_POZ_ZBTB44 15..130 CDD:349537
zf-C2H2 399..421 CDD:333835 7/21 (33%)
C2H2 Zn finger 401..421 CDD:275368 6/19 (32%)
zf-H2C2_2 413..438 CDD:372612 11/24 (46%)
C2H2 Zn finger 429..449 CDD:275368 9/19 (47%)
C2H2 Zn finger 457..476 CDD:275368 4/18 (22%)
zf-C2H2 487..508 CDD:333835 7/20 (35%)
C2H2 Zn finger 489..511 CDD:275371 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24383
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.