DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qin and LCL3

DIOPT Version :9

Sequence 1:NP_650735.3 Gene:qin / 42236 FlyBaseID:FBgn0263974 Length:1857 Species:Drosophila melanogaster
Sequence 2:NP_011430.1 Gene:LCL3 / 852795 SGDID:S000003053 Length:274 Species:Saccharomyces cerevisiae


Alignment Length:270 Identity:56/270 - (20%)
Similarity:92/270 - (34%) Gaps:73/270 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   598 ALVSQKLTNENL-----YNVFLTDIGVHLHVRCSDFRVVPERI--SHLPYSAVHCSLSE------ 649
            |::|..||...|     |..:||..     .|.:|   :|.||  .|..|..| .|:.:      
Yeast    15 AVLSIILTGSTLTLIYTYKRYLTQF-----KRTND---IPRRIFRKHWLYGKV-TSVGDGDNFHF 70

  Fly   650 -LMPKNGESEWDSKASAFLK---QIVQN-NPVRVIVKKALTYELHGVDLITSNYDTNISV---RD 706
             .||......|     .:|:   |:::| :....:|..:........:.||....|...:   :.
Yeast    71 FHMPGGIRGGW-----GWLRPVPQMIKNDSTAEKLVGDSRNMRFFNFNWITHGRSTKSKIQKAKS 130

  Fly   707 SFLYCGLAISRDGAPLWLPPAPTALRLPRISFRFGDVYMVQMLHVEDPQEFYVMRHDYEKKRLWL 771
            .||...:            |......||.|..|...:...:..|..:|.:.:     ..:..:||
Yeast   131 QFLKLNV------------PYKNRKNLPTIPIRLCGIDAPERAHFGNPAQPF-----GNEALIWL 178

  Fly   772 Q---FSLQEAMDRINISQLQNIFLGQLHLGCVLQSG-----GQWKRASIEQILPDGYVLVHLVDE 828
            |   ...:..:..::|.|...         ||.:..     |.||..|:| :|.||..:|:   |
Yeast   179 QNRILGKKVWVKPLSIDQYNR---------CVARVSYWDWFGGWKDLSLE-MLKDGLAVVY---E 230

  Fly   829 GPSQKVFWDQ 838
            |.....|.|:
Yeast   231 GKVNTEFDDR 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qinNP_650735.3 zf-RING_5 25..75 CDD:291308
BBOX 139..174 CDD:197662
TUDOR 536..648 CDD:278965 17/56 (30%)
TUDOR 741..859 CDD:278965 22/106 (21%)
TUDOR <805..839 CDD:119391 13/34 (38%)
TUDOR 981..1107 CDD:278965
TUDOR 1296..1403 CDD:278965
TUDOR 1337..1385 CDD:119391
TUDOR 1710..1761 CDD:119391
LCL3NP_011430.1 SNase 149..261 CDD:395448 23/110 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.