DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qin and CG15042

DIOPT Version :9

Sequence 1:NP_650735.3 Gene:qin / 42236 FlyBaseID:FBgn0263974 Length:1857 Species:Drosophila melanogaster
Sequence 2:NP_573308.1 Gene:CG15042 / 32844 FlyBaseID:FBgn0030937 Length:436 Species:Drosophila melanogaster


Alignment Length:350 Identity:67/350 - (19%)
Similarity:122/350 - (34%) Gaps:95/350 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1124 MDQLKAYNEIHVTGRGRTENSLSVILWGSLSILTGPFSPA--------TIKYVNINKALLMAGMA 1180
            ::||..|.||... ..:.||.:|.|      .:..|..|.        ..||.|      |:|| 
  Fly   115 LEQLPDYGEIFAF-YDKAENRISRI------AINAPVHPMGYCAYMIDAAKYTN------MSGM- 165

  Fly  1181 EKDHNSDSEDDQQSMPE-NVSVNSEEAAKANDW--ESCLSKIDGTSKTNDSLNLIESRSVTVGFE 1242
              :......||.:.:|. .:.......|:.:.:  ::...::.|::.....:.||.:|: .:...
  Fly   166 --ERIFALPDDLKKLPALTIKCRLVNVAQMHIFITQNVRLRVLGSNGLELLVALIRNRT-NIRKI 227

  Fly  1243 HNEDMPPLALLEDLGNTKNTTGETTPP-AGWTTRRKCDKSVFTAIATNVTYECCIYLTLASDKPF 1306
            .:..:||:: .::.||......|.... |.:..:|:...|:.....|.:......|...| |.|.
  Fly   228 PSAQLPPIS-GDEYGNMDANDREVAKSFARYRPKRRERGSIVRVHVTRIVSHAEFYARFA-DGPT 290

  Fly  1307 IEHMGNLLVREYKPLMDKQKERSTSYTYKVGQAVVV----TYHMDNM--IYRGIVQRLENNHNEY 1365
            :            |...|...:..:..::|...|:.    .||...:  |:|          ..|
  Fly   291 V------------PTWSKSVMKRGTGDFRVWDIVLAPYQGRYHRAKIVDIFR----------CRY 333

  Fly  1366 TVYYVDYG--------NM----ELVKADEMLPY----------APFPDLNAMCFL---------- 1398
            .||::|:|        |:    ||.||...|.:          .|.|.:|.:..:          
  Fly   334 RVYFLDFGITEYTSKKNLTFCYELEKAQHNLAFRFEILGTRRQCPIPYINILEGIKHLEHTVLRS 398

  Fly  1399 ---VELHGVRSKQGKYSLKEMDTVH 1420
               |.:|.: .|.|.|.::.|..:|
  Fly   399 DINVRIHNI-LKDGGYVIRLMKHIH 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qinNP_650735.3 zf-RING_5 25..75 CDD:291308
BBOX 139..174 CDD:197662
TUDOR 536..648 CDD:278965
TUDOR 741..859 CDD:278965
TUDOR <805..839 CDD:119391
TUDOR 981..1107 CDD:278965
TUDOR 1296..1403 CDD:278965 27/147 (18%)
TUDOR 1337..1385 CDD:119391 15/65 (23%)
TUDOR 1710..1761 CDD:119391
CG15042NP_573308.1 TUDOR 310..351 CDD:119391 10/50 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1525
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22948
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.