DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14301 and CG13643

DIOPT Version :9

Sequence 1:NP_650734.2 Gene:CG14301 / 42235 FlyBaseID:FBgn0038632 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001262937.1 Gene:CG13643 / 50074 FlyBaseID:FBgn0040601 Length:819 Species:Drosophila melanogaster


Alignment Length:97 Identity:35/97 - (36%)
Similarity:48/97 - (49%) Gaps:17/97 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 GRPGVDYPILSAVPYTNFYCDEQEYPGFFADMETRCQGWHYC-DIDG-----RQAT--------- 134
            |||...|. |..:|.|.|.|.::...|::||.||:||.:|.| .:.|     |:|.         
  Fly    38 GRPWPTYS-LQNMPKTQFTCHDKILGGYYADPETQCQMFHVCVKLPGVGLLHRRANPFVQQVQDY 101

  Fly   135 -FLCPNGTQFSQAVFVCDWWFNVRCDLSPRLY 165
             |||||.|.|.|.:.:|..|.:|.||.:...|
  Fly   102 RFLCPNTTAFDQELQICANWLDVDCDKATSFY 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14301NP_650734.2 CBM_14 104..156 CDD:279884 23/67 (34%)
CG13643NP_001262937.1 CBM_14 63..126 CDD:279884 23/62 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.